(data stored in ACNUC7421 zone)

EMBL: CP000529.PE454

CP000529.PE454       Location/Qualifiers
FT   CDS             480874..482004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0459"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   pol:Bpro_4185 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35781"
FT                   /db_xref="GOA:A1VJF3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF3"
FT                   /protein_id="ABM35781.1"
FT                   /translation="MILNDDQEQVRDAVRAFAQAELWPHAARWDKEHYFPKEAHKGLAA
FT                   LGAYGICVPEEFGGANLDYVTLALVLEEIAAGDGGTSTAISVTNCPVNAILMRYGNPAQ
FT                   KKQWLMPLAQGDLLGAFCLTEPHTGSDASSLRTTAVKDGDGYVLSGVKQFITSGQNGQV
FT                   AIVIAVTDKGAGKKGMSAFIVPTDAPGYSASRLEDKLGQHSSDTAQVNFDNCRIPAENL
FT                   IGAEGEGYKIALGGLEGGRIGIAAQSVGMARSAFEVAVAYAKERQSFGSAIFNHQAVGF
FT                   RLADCATQLEAARQLIWHAASLRDAGRPCLKEAAMAKLFASEMAEKVCSAAIQTLGGYG
FT                   YVSDFPVERIYRDVRVCQIYEGTSDVQKIIIQRALA"
     MILNDDQEQV RDAVRAFAQA ELWPHAARWD KEHYFPKEAH KGLAALGAYG ICVPEEFGGA        60
     NLDYVTLALV LEEIAAGDGG TSTAISVTNC PVNAILMRYG NPAQKKQWLM PLAQGDLLGA       120
     FCLTEPHTGS DASSLRTTAV KDGDGYVLSG VKQFITSGQN GQVAIVIAVT DKGAGKKGMS       180
     AFIVPTDAPG YSASRLEDKL GQHSSDTAQV NFDNCRIPAE NLIGAEGEGY KIALGGLEGG       240
     RIGIAAQSVG MARSAFEVAV AYAKERQSFG SAIFNHQAVG FRLADCATQL EAARQLIWHA       300
     ASLRDAGRPC LKEAAMAKLF ASEMAEKVCS AAIQTLGGYG YVSDFPVERI YRDVRVCQIY       360
     EGTSDVQKII IQRALA                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page