(data stored in ACNUC7421 zone)

EMBL: CP000529.PE457

CP000529.PE457       Location/Qualifiers
FT   CDS             complement(483853..484824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35784"
FT                   /db_xref="GOA:A1VJF6"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF6"
FT                   /protein_id="ABM35784.1"
FT                   /translation="MKDETVFAKEAEQEPPAPGQRPEHTMGTPAEATKPVSRPERLLRQ
FT                   LLLKRPKIVILAWAVVVLVFLLLLPLAYLAWFQLPGRLWAFANEQWWHWIPAFLGFIAI
FT                   VFIPLWAVMGAIALAGFLADISLSIEHAAIQDAQRVVRETEQDAISRLELTDVAGLLPL
FT                   LKYSRAQLDAYYAIGLNQTRKSFFNAVLAMWLGFILLLIGIALYVGPVEKLGLTRPQQD
FT                   FQILILSGAAIIEFVSALFLWVYRSTTAQLTYYYKRQMHSHTSILCFRMATTIQTLEKS
FT                   DEIKKAIIEKVLDWNEMPERPPLVGAKGLRSLLPASEAKATP"
     MKDETVFAKE AEQEPPAPGQ RPEHTMGTPA EATKPVSRPE RLLRQLLLKR PKIVILAWAV        60
     VVLVFLLLLP LAYLAWFQLP GRLWAFANEQ WWHWIPAFLG FIAIVFIPLW AVMGAIALAG       120
     FLADISLSIE HAAIQDAQRV VRETEQDAIS RLELTDVAGL LPLLKYSRAQ LDAYYAIGLN       180
     QTRKSFFNAV LAMWLGFILL LIGIALYVGP VEKLGLTRPQ QDFQILILSG AAIIEFVSAL       240
     FLWVYRSTTA QLTYYYKRQM HSHTSILCFR MATTIQTLEK SDEIKKAIIE KVLDWNEMPE       300
     RPPLVGAKGL RSLLPASEAK ATP                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page