(data stored in ACNUC7421 zone)

EMBL: CP000529.PE459

CP000529.PE459       Location/Qualifiers
FT   CDS             complement(485332..485946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0464"
FT                   /product="protein of unknown function DUF1326"
FT                   /note="PFAM: protein of unknown function DUF1326; KEGG:
FT                   mlo:mll4476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35786"
FT                   /db_xref="InterPro:IPR009758"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF8"
FT                   /protein_id="ABM35786.1"
FT                   /translation="MSSWQITGQYMETCNCAFLCPCITSNLTARPTEGDCKAAVTMHID
FT                   KGAKDGIALDGLSFVLILHSPGPMGEGNMTVGLIVDNTASDQQLEAISAIASGSAGGPM
FT                   AALAPLVSTNAGVERRPIRFEVDGLNYAMSAGELVDQACEGLPSVTDPEQAIGIDNTAH
FT                   PVNSRLSLAKAKRSRFHAFGIDWEDATGTRNGHFAPFAWAG"
     MSSWQITGQY METCNCAFLC PCITSNLTAR PTEGDCKAAV TMHIDKGAKD GIALDGLSFV        60
     LILHSPGPMG EGNMTVGLIV DNTASDQQLE AISAIASGSA GGPMAALAPL VSTNAGVERR       120
     PIRFEVDGLN YAMSAGELVD QACEGLPSVT DPEQAIGIDN TAHPVNSRLS LAKAKRSRFH       180
     AFGIDWEDAT GTRNGHFAPF AWAG                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page