(data stored in ACNUC7421 zone)

EMBL: CP000529.PE460

CP000529.PE460       Location/Qualifiers
FT   CDS             486200..486994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35787"
FT                   /db_xref="GOA:A1VJF9"
FT                   /db_xref="InterPro:IPR018688"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF9"
FT                   /protein_id="ABM35787.1"
FT                   /translation="MRQQKPDSANKTPQGLLTLATRQPKLATGILAISVIGWLFLAWIA
FT                   VDMSQPFAQLTMPDSSQWGAASVLAIWTMWALMMAAMMLPSALPMILTFVDLGVRTAEP
FT                   ARGRSFVAAYLFVWFAFSAGATAAQWVLQAMGWVNPMIVSSSALLTALLLLIAGAYQFS
FT                   RLKQVCLSRCRTPMGFLLGEWRAGVYGAFVMGVRHGLFCVGCCWALMALLFVGGVMNLA
FT                   WVAALSITVAIEKLAPRGERLASALGLGLIAAGLAKLLVLVS"
     MRQQKPDSAN KTPQGLLTLA TRQPKLATGI LAISVIGWLF LAWIAVDMSQ PFAQLTMPDS        60
     SQWGAASVLA IWTMWALMMA AMMLPSALPM ILTFVDLGVR TAEPARGRSF VAAYLFVWFA       120
     FSAGATAAQW VLQAMGWVNP MIVSSSALLT ALLLLIAGAY QFSRLKQVCL SRCRTPMGFL       180
     LGEWRAGVYG AFVMGVRHGL FCVGCCWALM ALLFVGGVMN LAWVAALSIT VAIEKLAPRG       240
     ERLASALGLG LIAAGLAKLL VLVS                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page