(data stored in ACNUC7421 zone)

EMBL: CP000529.PE461

CP000529.PE461       Location/Qualifiers
FT   CDS             487094..487504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35788"
FT                   /db_xref="InterPro:IPR023006"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJG0"
FT                   /protein_id="ABM35788.1"
FT                   /translation="MTTPCPCGRTSANSAKPAKTQPLPFFACCGPYLNESVPAPDAHAL
FT                   MRSRYSAFVLQRADYLLATWHASTRPAALDFAPGAKWLGLDVRSHRVLDADHAEVEFVA
FT                   RCREAGRATRLHERSRFVRESERWFYVDGDQF"
     MTTPCPCGRT SANSAKPAKT QPLPFFACCG PYLNESVPAP DAHALMRSRY SAFVLQRADY        60
     LLATWHASTR PAALDFAPGA KWLGLDVRSH RVLDADHAEV EFVARCREAG RATRLHERSR       120
     FVRESERWFY VDGDQF                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page