(data stored in ACNUC7421 zone)

EMBL: CP000529.PE462

CP000529.PE462       Location/Qualifiers
FT   CDS             487567..488226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0467"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bxe:Bxe_B1631 HAD-superfamily hydrolase,
FT                   subfamily IA, variant3"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35789"
FT                   /db_xref="GOA:A1VJG1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG1"
FT                   /protein_id="ABM35789.1"
FT                   /translation="MKFEAILFDCDGVLVDSEPITNGVLRDMLEEGGWSLTPAECMRVF
FT                   VGKAVRDERLLIEAKTGQPLTEDWMAEFYARRNRELQARLTAIAGAHEAVAAAHAHVAE
FT                   RIACASGADRFKVEMQLAQVGLMDYFAGRIFSGHEMPRSKPAPDVYLAAAAHLGAAGAR
FT                   CLVIEDTTTGVTAGIAAGATVWAYCPQPEQGAVLRQAGASQLFAHMAELPGLLAAV"
     MKFEAILFDC DGVLVDSEPI TNGVLRDMLE EGGWSLTPAE CMRVFVGKAV RDERLLIEAK        60
     TGQPLTEDWM AEFYARRNRE LQARLTAIAG AHEAVAAAHA HVAERIACAS GADRFKVEMQ       120
     LAQVGLMDYF AGRIFSGHEM PRSKPAPDVY LAAAAHLGAA GARCLVIEDT TTGVTAGIAA       180
     GATVWAYCPQ PEQGAVLRQA GASQLFAHMA ELPGLLAAV                              219
//

If you have problems or comments...

PBIL Back to PBIL home page