(data stored in ACNUC7421 zone)

EMBL: CP000529.PE463

CP000529.PE463       Location/Qualifiers
FT   CDS             complement(488415..488861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0468"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein,; KEGG:
FT                   nha:Nham_1961 ion transport 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35790"
FT                   /db_xref="GOA:A1VJG2"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG2"
FT                   /protein_id="ABM35790.1"
FT                   /translation="MVLVIFSCLLLIALTTLMHYEVLSSLNLRLPALAMPSRAKLLVVI
FT                   FAAFMAHALEIALYGFALFGLVQYVGGVGGLTGAGDSSLQNCLYFSAETYSSLGFGDLI
FT                   PNGPIRLLAGVEALNGLLLIGWSASYAYIAMERFWGSGSGDGES"
     MVLVIFSCLL LIALTTLMHY EVLSSLNLRL PALAMPSRAK LLVVIFAAFM AHALEIALYG        60
     FALFGLVQYV GGVGGLTGAG DSSLQNCLYF SAETYSSLGF GDLIPNGPIR LLAGVEALNG       120
     LLLIGWSASY AYIAMERFWG SGSGDGES                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page