(data stored in ACNUC7421 zone)

EMBL: CP000529.PE464

CP000529.PE464       Location/Qualifiers
FT   CDS             complement(488880..489941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0469"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: rfr:Rfer_3834 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35791"
FT                   /db_xref="GOA:A1VJG3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG3"
FT                   /protein_id="ABM35791.1"
FT                   /translation="MPELCATPASPRPALEPAITPMAFVQAIALAYERRGLSPAAALAQ
FT                   AQIAPSSLHDASTCITAWQMERLCGTAMQELDDEALGWFSRRLPWGSYGMLARASLSAP
FT                   SLGVALKRWCRHHGLIADDIALTLSVSGDTALLAITEQRDLGALREFCLVSVLRNILGV
FT                   ACWLIDSRIPLLGAQFPFAAPPHRDVYAVLFSGPTAFDTAPAGLRFDARYLALPLRRDE
FT                   RALQQMLERALPLTVLPYRRDRLLVQRVRQALAANPAQTHSAQALAALVHVSPRTLHRQ
FT                   LKEEGASLQALKDEVRRARALELLLRTRRPIKQVAEAAGFQNEKSFMRAFKTWTGQSPA
FT                   EFRRGGQGLDSSA"
     MPELCATPAS PRPALEPAIT PMAFVQAIAL AYERRGLSPA AALAQAQIAP SSLHDASTCI        60
     TAWQMERLCG TAMQELDDEA LGWFSRRLPW GSYGMLARAS LSAPSLGVAL KRWCRHHGLI       120
     ADDIALTLSV SGDTALLAIT EQRDLGALRE FCLVSVLRNI LGVACWLIDS RIPLLGAQFP       180
     FAAPPHRDVY AVLFSGPTAF DTAPAGLRFD ARYLALPLRR DERALQQMLE RALPLTVLPY       240
     RRDRLLVQRV RQALAANPAQ THSAQALAAL VHVSPRTLHR QLKEEGASLQ ALKDEVRRAR       300
     ALELLLRTRR PIKQVAEAAG FQNEKSFMRA FKTWTGQSPA EFRRGGQGLD SSA              353
//

If you have problems or comments...

PBIL Back to PBIL home page