(data stored in ACNUC7421 zone)

EMBL: CP000529.PE467

CP000529.PE467       Location/Qualifiers
FT   CDS             493424..493945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0472"
FT                   /product="DinB family protein"
FT                   /note="PFAM: DinB family protein; KEGG: sme:SMc00593
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35794"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG6"
FT                   /protein_id="ABM35794.1"
FT                   /translation="MNLNVYFATLARYNVWATQRLLEAVADVPDDGYRCDAGLFFRSIH
FT                   GTLAHLLVGEHQLWFRRFAEGVSPVVALDADLVPERQALAAQLLAGARRWEPLVASLPP
FT                   ERFDGLLNYTTMRGQPASLPFAATLGHVFNHGTHHRGQITAALTALGRPCPELDMVYFL
FT                   QTQPHQESPA"
     MNLNVYFATL ARYNVWATQR LLEAVADVPD DGYRCDAGLF FRSIHGTLAH LLVGEHQLWF        60
     RRFAEGVSPV VALDADLVPE RQALAAQLLA GARRWEPLVA SLPPERFDGL LNYTTMRGQP       120
     ASLPFAATLG HVFNHGTHHR GQITAALTAL GRPCPELDMV YFLQTQPHQE SPA              173
//

If you have problems or comments...

PBIL Back to PBIL home page