(data stored in ACNUC7421 zone)

EMBL: CP000529.PE469

CP000529.PE469       Location/Qualifiers
FT   CDS             494747..495418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0474"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: pol:Bpro_4158 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35796"
FT                   /db_xref="GOA:A1VJG8"
FT                   /db_xref="InterPro:IPR025196"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG8"
FT                   /protein_id="ABM35796.1"
FT                   /translation="MQALDTAQLIALAGALGWASGVRLYLVMLLTGLAGYMGWMELPQG
FT                   LHLLANPVVLGASGFMVFVEFFADKIPGLDSLWDVVHTVIRIPAGAALAAGVFGADSSA
FT                   MGLAAALVGGTLAATSHAAKATSRAAINTSPEPFTNIGTSLVEDSLVPAGLWLAIAHPL
FT                   VFIPLLALVLVLSIWLIRLCWRFLTQLFARVARIFSGKPDAGLPPAFTLKSPFSKNDPH
FT                   V"
     MQALDTAQLI ALAGALGWAS GVRLYLVMLL TGLAGYMGWM ELPQGLHLLA NPVVLGASGF        60
     MVFVEFFADK IPGLDSLWDV VHTVIRIPAG AALAAGVFGA DSSAMGLAAA LVGGTLAATS       120
     HAAKATSRAA INTSPEPFTN IGTSLVEDSL VPAGLWLAIA HPLVFIPLLA LVLVLSIWLI       180
     RLCWRFLTQL FARVARIFSG KPDAGLPPAF TLKSPFSKND PHV                         223
//

If you have problems or comments...

PBIL Back to PBIL home page