(data stored in ACNUC7421 zone)

EMBL: CP000529.PE470

CP000529.PE470       Location/Qualifiers
FT   CDS             495411..497423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0475"
FT                   /product="3-methylcrotonoyl-CoA carboxylase, alpha subunit"
FT                   /EC_number="6.4.1.4"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein,
FT                   ATP-grasp; Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   pol:Bpro_4157 carbamoyl-phosphate synthase L chain,
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35797"
FT                   /db_xref="GOA:A1VJG9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG9"
FT                   /protein_id="ABM35797.1"
FT                   /translation="MFKKILIANRGEIACRVAATARRMAVKTVAVYSDADASAKHVGYC
FT                   DEAVHIGGSAPKDSYLRWERIIEAAKATGAEAIHPGYGFLSENEEFAKACAGAGLVFIG
FT                   PPASAIKAMGLKAESKQLMEKAGVPLVPGYHGADQDPVMLKHEADRIGYPVLIKASAGG
FT                   GGKGMRAVEKSEDFAAALASCKREAINSFGNDTVLVEKYAQRPRHIEIQVFGDMHGNYV
FT                   YLFERDCSVQRRHQKVLEEAPAPGLSPEMRQQMGLAAVAAARAVNYVGAGTVEFIVEQR
FT                   ADGSMNFFFMEMNTRLQVEHPVTEAITGLDLVEWQLRVASGEPLPLAQDQLKINGHAIE
FT                   ARICAENPDNNFLPTTGTLHVYDKPLCTAFERADLSNAGIAVRIDDGVRQGDTISPFYD
FT                   SMVAKLIVHGQTREEALARMDEALAQTRIVGLATNVQFLRYVVRSPSFAQANLDTALIP
FT                   REEAVLFKQEPVGLPLAAAAAIAQTLLSEKATEGADPFSRRDGWQTHGVTQRPFEFDFH
FT                   GEPAKAALTYRHDGALQLTVGDVSGPLVFAQSGQGIAIQFAGQRLSATVYTQGEVDHVF
FT                   TARGATQITAIDLLAHAGESHTEGGRLTAPMPGKILSFSVKAGDLVQKGQPLAVMEAMK
FT                   MEHTIAAPADGVVEELMYAPGDQVTEGSELLKITV"
     MFKKILIANR GEIACRVAAT ARRMAVKTVA VYSDADASAK HVGYCDEAVH IGGSAPKDSY        60
     LRWERIIEAA KATGAEAIHP GYGFLSENEE FAKACAGAGL VFIGPPASAI KAMGLKAESK       120
     QLMEKAGVPL VPGYHGADQD PVMLKHEADR IGYPVLIKAS AGGGGKGMRA VEKSEDFAAA       180
     LASCKREAIN SFGNDTVLVE KYAQRPRHIE IQVFGDMHGN YVYLFERDCS VQRRHQKVLE       240
     EAPAPGLSPE MRQQMGLAAV AAARAVNYVG AGTVEFIVEQ RADGSMNFFF MEMNTRLQVE       300
     HPVTEAITGL DLVEWQLRVA SGEPLPLAQD QLKINGHAIE ARICAENPDN NFLPTTGTLH       360
     VYDKPLCTAF ERADLSNAGI AVRIDDGVRQ GDTISPFYDS MVAKLIVHGQ TREEALARMD       420
     EALAQTRIVG LATNVQFLRY VVRSPSFAQA NLDTALIPRE EAVLFKQEPV GLPLAAAAAI       480
     AQTLLSEKAT EGADPFSRRD GWQTHGVTQR PFEFDFHGEP AKAALTYRHD GALQLTVGDV       540
     SGPLVFAQSG QGIAIQFAGQ RLSATVYTQG EVDHVFTARG ATQITAIDLL AHAGESHTEG       600
     GRLTAPMPGK ILSFSVKAGD LVQKGQPLAV MEAMKMEHTI AAPADGVVEE LMYAPGDQVT       660
     EGSELLKITV                                                              670
//

If you have problems or comments...

PBIL Back to PBIL home page