(data stored in ACNUC7421 zone)

EMBL: CP000529.PE479

CP000529.PE479       Location/Qualifiers
FT   CDS             506556..508214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0485"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: pol:Bpro_4142 general
FT                   substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35806"
FT                   /db_xref="GOA:A1VJH8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH8"
FT                   /protein_id="ABM35806.1"
FT                   /translation="MATTVDKSVMTAEQRKVIFASSLGTVFEWYDFYLYGSLAAIIAKQ
FT                   FFSGLDAGSAFIFALLAFAAGFIVRPFGALVFGRLGDMIGRKYTFLVTIVIMGLSTFIV
FT                   GLLPSYASIGVAAPVILIALRMLQGLALGGEYGGAAVYVAEHAPEGRRGAYTSWIQTTA
FT                   TMGLFLSLLVILGVRTAVGEVAFADWGWRVPFVVSILLLAVSVYIRLSMNESPAFQKMK
FT                   AEGRTSKAPLSESFGQWKNLKIVILALVGLTAGQAVVWYSGQFYSLFFLTQALKVDGPT
FT                   ANILVAYSLLLATPFFVVFGTLSDKIGRKPIIMAGCLLAALTYFPVFTALTKAANPDLA
FT                   EAQARNQVVVTADPKECSFQFNPTGTAKFTSSCDIAKQVLAGASVSYENVAGPAGTVAS
FT                   IKIGQNAIPSYTAKGLSADEARKKDVEFKKLIGDDLKAAGYPSKADPAKMDKVMVTAIL
FT                   FYLVLLVTMVYGPIAAMLVEMFPTRIRYTSMSLPYHIGNGWFGGLLPTTAFAIVAQTGN
FT                   MYNGLWYPIIIAGVTFVVGTLFVKETKDYDIYAND"
     MATTVDKSVM TAEQRKVIFA SSLGTVFEWY DFYLYGSLAA IIAKQFFSGL DAGSAFIFAL        60
     LAFAAGFIVR PFGALVFGRL GDMIGRKYTF LVTIVIMGLS TFIVGLLPSY ASIGVAAPVI       120
     LIALRMLQGL ALGGEYGGAA VYVAEHAPEG RRGAYTSWIQ TTATMGLFLS LLVILGVRTA       180
     VGEVAFADWG WRVPFVVSIL LLAVSVYIRL SMNESPAFQK MKAEGRTSKA PLSESFGQWK       240
     NLKIVILALV GLTAGQAVVW YSGQFYSLFF LTQALKVDGP TANILVAYSL LLATPFFVVF       300
     GTLSDKIGRK PIIMAGCLLA ALTYFPVFTA LTKAANPDLA EAQARNQVVV TADPKECSFQ       360
     FNPTGTAKFT SSCDIAKQVL AGASVSYENV AGPAGTVASI KIGQNAIPSY TAKGLSADEA       420
     RKKDVEFKKL IGDDLKAAGY PSKADPAKMD KVMVTAILFY LVLLVTMVYG PIAAMLVEMF       480
     PTRIRYTSMS LPYHIGNGWF GGLLPTTAFA IVAQTGNMYN GLWYPIIIAG VTFVVGTLFV       540
     KETKDYDIYA ND                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page