(data stored in ACNUC7421 zone)

EMBL: CP000529.PE480

CP000529.PE480       Location/Qualifiers
FT   CDS             508230..508733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35807"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH9"
FT                   /protein_id="ABM35807.1"
FT                   /translation="MIYVKTESGQSALLSRSLALTPRQRSAFIMFDGKRSMKEVLKATE
FT                   GLGITQDDVAHMVTRGLLVPISTANKVAAMVSLPGAPVIAAAPAPLAPAPQPQADRQDA
FT                   QAHYSKAYPIATRLTAGLGLRGFLLNLAVEAAGDLGKLRELAPKIEQAVGPEKFRELEN
FT                   ALYE"
     MIYVKTESGQ SALLSRSLAL TPRQRSAFIM FDGKRSMKEV LKATEGLGIT QDDVAHMVTR        60
     GLLVPISTAN KVAAMVSLPG APVIAAAPAP LAPAPQPQAD RQDAQAHYSK AYPIATRLTA       120
     GLGLRGFLLN LAVEAAGDLG KLRELAPKIE QAVGPEKFRE LENALYE                     167
//

If you have problems or comments...

PBIL Back to PBIL home page