(data stored in ACNUC7421 zone)

EMBL: CP000529.PE483

CP000529.PE483       Location/Qualifiers
FT   CDS             516348..517784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0489"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: pol:Bpro_4132 adenosylhomocysteinase; TIGRFAM:
FT                   adenosylhomocysteinase; PFAM: S-adenosyl-L-homocysteine
FT                   hydrolase; TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35810"
FT                   /db_xref="GOA:A1VJI2"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI2"
FT                   /protein_id="ABM35810.1"
FT                   /translation="MNIALKTMLNTDHIIADLTLAAWGRKELKIAETEMPGLMAIRQEF
FT                   AAAQPLKGARITGSLHMTIQTGVLIETLQALGAEVRWASCNIFSTQDHAAAAIAAEGTP
FT                   VFAVKGETLADYWDYTHRIFEFTGAKGTPEEGPNMILDDGGDATLLMHLGARAETDASL
FT                   LEYPASEEETCLFGAIKAKLAQDPTWYSRRLANIIGVTEETTTGVLRLNEMSAKGTLAF
FT                   RAINVNDSVTKSKFDNLYGCRESLVDAIKRATDVMIAGKVAVVAGYGDVGKGCAQALRA
FT                   LSAQVWVTEIDPINALQAAMEGYKVVTMDYAADKCDIFVSATGNKNVITYAHMAAMKDQ
FT                   AIVCNIGHFDNEIDVASLESCNWEEIKPQVDHVIFPDGKRIILLAKGRLVNLGCGTGHP
FT                   SFVMSSSFANQTIAQIELFTKQAEYEAGKVYVLPKHLDEKVARLHLKKVGAMLSELSDE
FT                   QAAYIGVSKAGPYKANTYRY"
     MNIALKTMLN TDHIIADLTL AAWGRKELKI AETEMPGLMA IRQEFAAAQP LKGARITGSL        60
     HMTIQTGVLI ETLQALGAEV RWASCNIFST QDHAAAAIAA EGTPVFAVKG ETLADYWDYT       120
     HRIFEFTGAK GTPEEGPNMI LDDGGDATLL MHLGARAETD ASLLEYPASE EETCLFGAIK       180
     AKLAQDPTWY SRRLANIIGV TEETTTGVLR LNEMSAKGTL AFRAINVNDS VTKSKFDNLY       240
     GCRESLVDAI KRATDVMIAG KVAVVAGYGD VGKGCAQALR ALSAQVWVTE IDPINALQAA       300
     MEGYKVVTMD YAADKCDIFV SATGNKNVIT YAHMAAMKDQ AIVCNIGHFD NEIDVASLES       360
     CNWEEIKPQV DHVIFPDGKR IILLAKGRLV NLGCGTGHPS FVMSSSFANQ TIAQIELFTK       420
     QAEYEAGKVY VLPKHLDEKV ARLHLKKVGA MLSELSDEQA AYIGVSKAGP YKANTYRY         478
//

If you have problems or comments...

PBIL Back to PBIL home page