(data stored in ACNUC7421 zone)

EMBL: CP000529.PE489

CP000529.PE489       Location/Qualifiers
FT   CDS             522761..523792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0495"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase, subunit II;
FT                   KEGG: pol:Bpro_4116 cytochrome bd ubiquinol oxidase,
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35816"
FT                   /db_xref="GOA:A1VJI8"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI8"
FT                   /protein_id="ABM35816.1"
FT                   /translation="MLDMAPNLTQAAGWMPIVFLGVMGLAMLAYVILDGYDLGVGMLMR
FT                   RASEDDKDSMIASIGPFWDANETWLVLGVGILLTVFPMAHGVILGALYLPVAMMLIGLT
FT                   LRGVAFDFRVKAHAARKPLWNRAFYAGSLMASWSQGYMLGSLITGFATTGWVIAFNAVI
FT                   GLALLSAYCLLGAGWLIIKSGGALQLQAVRWARASLWLTMAGIAAISLATPWVSPAIFD
FT                   KWFSFPNIVLLLPIPVATAVLFWVIYRSLQRLPTRLAQGNEYGIWVPFGATIGVFLLAF
FT                   YGLAYSLFPWLVIDRINIWQAAISPESMGVILAGAVVVLPMIIGYTVFSYRVFWGKSGA
FT                   LKY"
     MLDMAPNLTQ AAGWMPIVFL GVMGLAMLAY VILDGYDLGV GMLMRRASED DKDSMIASIG        60
     PFWDANETWL VLGVGILLTV FPMAHGVILG ALYLPVAMML IGLTLRGVAF DFRVKAHAAR       120
     KPLWNRAFYA GSLMASWSQG YMLGSLITGF ATTGWVIAFN AVIGLALLSA YCLLGAGWLI       180
     IKSGGALQLQ AVRWARASLW LTMAGIAAIS LATPWVSPAI FDKWFSFPNI VLLLPIPVAT       240
     AVLFWVIYRS LQRLPTRLAQ GNEYGIWVPF GATIGVFLLA FYGLAYSLFP WLVIDRINIW       300
     QAAISPESMG VILAGAVVVL PMIIGYTVFS YRVFWGKSGA LKY                         343
//

If you have problems or comments...

PBIL Back to PBIL home page