(data stored in ACNUC7421 zone)

EMBL: CP000529.PE491

CP000529.PE491       Location/Qualifiers
FT   CDS             complement(524874..526469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0497"
FT                   /product="regulator of RNA terminal phosphate cyclase"
FT                   /note="PFAM: magnesium chelatase, ChlI subunit; sigma-54
FT                   factor, interaction domain-containing protein; regulator of
FT                   RNA terminal phosphate cyclase; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_1470 regulator of RNA terminal phosphate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35818"
FT                   /db_xref="GOA:A1VJJ0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009715"
FT                   /db_xref="InterPro:IPR017183"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJJ0"
FT                   /protein_id="ABM35818.1"
FT                   /translation="MKRKVVIGFLGSQLDSGLGAARWDKWRPTVSLAQHDDLQVDRLEL
FT                   LHDVRYLALARTVQADIAQLSPGTEVRLSEMNLANPWDFGEVYGALYDWLKTYPFELEQ
FT                   EDYWAHITTGTHVAQICLFLMVEARLIPGVLLQTAPPRRQGSQAAGSYELIDLDLSRYD
FT                   AINTRLRSARQDAVSFLKSGIATRNPRFNALIEEIERVAVRSTAPILLTGPTGAGKSML
FT                   ARRMYELKKSRHQVSGAFVDVNCATLRGDGAVSALFGHRKGAFTGAAMERAGLLKTAHQ
FT                   GVLFLDEIGELGCDEQAMLLKAVEERRFLPLGSDAEVQSDFQLIAGTNKDLRTEVACGR
FT                   FREDLLARINLWSYVLPGLAQRREDIEPNIDHQLAIASQELGRQVRFTREARADYLGFA
FT                   QSGEALWSGNFRDLSASATRLATLAENGRIGVELVQAEKARLRWLWDKHPARDAASDVS
FT                   LHDLMGAAAEQLDAFDRLQLQAVIGICRQQASLSEAGRALFNVSRNQRAVINDADRLRK
FT                   YLLKFGLTWEQIRT"
     MKRKVVIGFL GSQLDSGLGA ARWDKWRPTV SLAQHDDLQV DRLELLHDVR YLALARTVQA        60
     DIAQLSPGTE VRLSEMNLAN PWDFGEVYGA LYDWLKTYPF ELEQEDYWAH ITTGTHVAQI       120
     CLFLMVEARL IPGVLLQTAP PRRQGSQAAG SYELIDLDLS RYDAINTRLR SARQDAVSFL       180
     KSGIATRNPR FNALIEEIER VAVRSTAPIL LTGPTGAGKS MLARRMYELK KSRHQVSGAF       240
     VDVNCATLRG DGAVSALFGH RKGAFTGAAM ERAGLLKTAH QGVLFLDEIG ELGCDEQAML       300
     LKAVEERRFL PLGSDAEVQS DFQLIAGTNK DLRTEVACGR FREDLLARIN LWSYVLPGLA       360
     QRREDIEPNI DHQLAIASQE LGRQVRFTRE ARADYLGFAQ SGEALWSGNF RDLSASATRL       420
     ATLAENGRIG VELVQAEKAR LRWLWDKHPA RDAASDVSLH DLMGAAAEQL DAFDRLQLQA       480
     VIGICRQQAS LSEAGRALFN VSRNQRAVIN DADRLRKYLL KFGLTWEQIR T                531
//

If you have problems or comments...

PBIL Back to PBIL home page