(data stored in ACNUC7421 zone)

EMBL: CP000529.PE495

CP000529.PE495       Location/Qualifiers
FT   CDS             529705..530097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0501"
FT                   /product="SSU ribosomal protein S9P"
FT                   /note="PFAM: ribosomal protein S9; KEGG: pol:Bpro_4112
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35822"
FT                   /db_xref="GOA:A1VJJ4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJJ4"
FT                   /protein_id="ABM35822.1"
FT                   /translation="MIGEWNNGTGRRKSSVARVFIKKGTGKITVNDKDIQAFFGRQTSI
FT                   MICRQPLFLTNHVETFDIMINVHGGGESGQAGAVRHGITRALIDYDATLKPALSQAGFV
FT                   TRDAREVERKKVGFRSARRRKQFSKR"
     MIGEWNNGTG RRKSSVARVF IKKGTGKITV NDKDIQAFFG RQTSIMICRQ PLFLTNHVET        60
     FDIMINVHGG GESGQAGAVR HGITRALIDY DATLKPALSQ AGFVTRDARE VERKKVGFRS       120
     ARRRKQFSKR                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page