(data stored in ACNUC7421 zone)

EMBL: CP000529.PE498

CP000529.PE498       Location/Qualifiers
FT   CDS             complement(533105..534244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0504"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   pol:Bpro_4108 protein of unknown function UPF0075"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35825"
FT                   /db_xref="GOA:A1VJJ7"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJJ7"
FT                   /protein_id="ABM35825.1"
FT                   /translation="MHDYTIGLMSGTSLDGADGVLVDFSSQTLRVVASASEPFGDSFRA
FT                   ELLALNSPSHNELHRAALAGSQLAAVYAQVVAKLVRQAGAQGISASQIQAIGAHGQTVR
FT                   HQPQRTSAEPAGAGYTLQLNNPALLAELTGIDVVADFRSRDVAAGGQGAPLVPAFHQGV
FT                   FGRADATVAVLNLGGISNLSVLPPAGSPLPVLGFDCGPGNALMDAWCLRHTGQPFDAGG
FT                   TWAKSGRLVPALLASLRGEPYFSQPIPKSTGRDLFSLAWLDEKLRPFSGERPEDIQNTL
FT                   TELTVFACTAGVSSYGKESTELIVCGGGAFNLYLLQRLQAGLPWLRVSTSDQHGLPPLQ
FT                   VEAAAFAWLARQMIQRQPGNLPGVTGAAGLRVLGALYPA"
     MHDYTIGLMS GTSLDGADGV LVDFSSQTLR VVASASEPFG DSFRAELLAL NSPSHNELHR        60
     AALAGSQLAA VYAQVVAKLV RQAGAQGISA SQIQAIGAHG QTVRHQPQRT SAEPAGAGYT       120
     LQLNNPALLA ELTGIDVVAD FRSRDVAAGG QGAPLVPAFH QGVFGRADAT VAVLNLGGIS       180
     NLSVLPPAGS PLPVLGFDCG PGNALMDAWC LRHTGQPFDA GGTWAKSGRL VPALLASLRG       240
     EPYFSQPIPK STGRDLFSLA WLDEKLRPFS GERPEDIQNT LTELTVFACT AGVSSYGKES       300
     TELIVCGGGA FNLYLLQRLQ AGLPWLRVST SDQHGLPPLQ VEAAAFAWLA RQMIQRQPGN       360
     LPGVTGAAGL RVLGALYPA                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page