(data stored in ACNUC7421 zone)

EMBL: CP000529.PE500

CP000529.PE500       Location/Qualifiers
FT   CDS             535905..537137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0506"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase, class Ib; RNA-binding S4 domain
FT                   protein; KEGG: pol:Bpro_4106 tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35827"
FT                   /db_xref="GOA:A1VJJ9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJJ9"
FT                   /protein_id="ABM35827.1"
FT                   /translation="MNQELVTNSPLSDRVKTALAVSLRGCDELIPQDEWTRKLVRSEAT
FT                   GVPLRIKLGLDPTAPDIHIGHTVVLNKMRQLQDLGHTVIFLIGDFTSLIGDPSGRNSTR
FT                   PPLTPEQIKVNAETYYRQASLVLDPAKTEIRYNSEWCDPLGARGMIQLASRYTVARMME
FT                   RNDFHDRFKAGQSISVHEFLYPLMQGYDSVALKSDLELGGTDQKFNLLMGRHLQQEYGQ
FT                   EPQCILTMPLLEGLDGIEKMSKSKNNYIGISEDANSMFAKVLSISDVLMWKWYTLLSFK
FT                   SEADIAALKAEIEAGRNPKDAKVALAKEITARFHSAAAADAAEQDFINRSKGGVPDEIP
FT                   DVSLSGAPLGIGALLKAAGLAPSGSEASRLIDGGGVRVDSSVVSDKALKLAAGTYVVQV
FT                   GKRKFARVTLA"
     MNQELVTNSP LSDRVKTALA VSLRGCDELI PQDEWTRKLV RSEATGVPLR IKLGLDPTAP        60
     DIHIGHTVVL NKMRQLQDLG HTVIFLIGDF TSLIGDPSGR NSTRPPLTPE QIKVNAETYY       120
     RQASLVLDPA KTEIRYNSEW CDPLGARGMI QLASRYTVAR MMERNDFHDR FKAGQSISVH       180
     EFLYPLMQGY DSVALKSDLE LGGTDQKFNL LMGRHLQQEY GQEPQCILTM PLLEGLDGIE       240
     KMSKSKNNYI GISEDANSMF AKVLSISDVL MWKWYTLLSF KSEADIAALK AEIEAGRNPK       300
     DAKVALAKEI TARFHSAAAA DAAEQDFINR SKGGVPDEIP DVSLSGAPLG IGALLKAAGL       360
     APSGSEASRL IDGGGVRVDS SVVSDKALKL AAGTYVVQVG KRKFARVTLA                  410
//

If you have problems or comments...

PBIL Back to PBIL home page