(data stored in ACNUC7421 zone)

EMBL: CP000529.PE502

CP000529.PE502       Location/Qualifiers
FT   CDS             complement(537696..538151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0508"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   rfr:Rfer_0737 protein of unknown function UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35829"
FT                   /db_xref="GOA:A1VJK1"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJK1"
FT                   /protein_id="ABM35829.1"
FT                   /translation="MALNSLSLSLQFGKFPDAALHRAALPRHSVARWIRHALQSDAEIT
FT                   VRIVGAEEGQALNRDYRAKDYATNVLTFDYTQAPYVTADLVLCAPVVAKEAQDNQKTLQ
FT                   AHYAHLLVHGTLHAQGYDHETGEEDAEEMEALEIEILAGLGFDNPYR"
     MALNSLSLSL QFGKFPDAAL HRAALPRHSV ARWIRHALQS DAEITVRIVG AEEGQALNRD        60
     YRAKDYATNV LTFDYTQAPY VTADLVLCAP VVAKEAQDNQ KTLQAHYAHL LVHGTLHAQG       120
     YDHETGEEDA EEMEALEIEI LAGLGFDNPY R                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page