(data stored in ACNUC7421 zone)

EMBL: CP000529.PE506

CP000529.PE506       Location/Qualifiers
FT   CDS             540753..541823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0512"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: pol:Bpro_4093 Holliday junction DNA helicase
FT                   RuvB; TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase, central domain protein; Holliday junction DNA
FT                   helicase RuvB, C-terminal domain; Holliday junction DNA
FT                   helicase RuvB, N-terminal domain; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35833"
FT                   /db_xref="GOA:A1VJK5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJK5"
FT                   /protein_id="ABM35833.1"
FT                   /translation="MTIQTDDFDMSDLPPARRMLSAAPASPKEEAIERALRPKLFDDYV
FT                   GQTKAREQLEIFIGAANKRQEALDHVLLFGPPGLGKTTLSHIIAHELGVNMRSTSGPVL
FT                   EKPKDLAALLTNLEKNDVLFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARSIKL
FT                   DLQPFTLVGATTRAGMLTNPLRDRFGIVARLEFYTPEELARIVKRSAGLLNAPMDAEGG
FT                   FEIARRSRGTPRIANRLLRRVRDYADVKGNGTITLDIANRALAMLDVDPQGFDLMDRKF
FT                   LEAVILRFDGGPVGLDNIAASIGEESGTIEDVIEPYLIQQGFLQRTPRGRIATLAAYRH
FT                   LGVAPPRGNAENLFEE"
     MTIQTDDFDM SDLPPARRML SAAPASPKEE AIERALRPKL FDDYVGQTKA REQLEIFIGA        60
     ANKRQEALDH VLLFGPPGLG KTTLSHIIAH ELGVNMRSTS GPVLEKPKDL AALLTNLEKN       120
     DVLFIDEIHR LSPVVEEILY PALEDYQIDI MIGEGPAARS IKLDLQPFTL VGATTRAGML       180
     TNPLRDRFGI VARLEFYTPE ELARIVKRSA GLLNAPMDAE GGFEIARRSR GTPRIANRLL       240
     RRVRDYADVK GNGTITLDIA NRALAMLDVD PQGFDLMDRK FLEAVILRFD GGPVGLDNIA       300
     ASIGEESGTI EDVIEPYLIQ QGFLQRTPRG RIATLAAYRH LGVAPPRGNA ENLFEE           356
//

If you have problems or comments...

PBIL Back to PBIL home page