(data stored in ACNUC7421 zone)

EMBL: CP000529.PE509

CP000529.PE509       Location/Qualifiers
FT   CDS             complement(543948..544574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35836"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJK8"
FT                   /protein_id="ABM35836.1"
FT                   /translation="MKRALTAIFSIAFMGLFMAGCSGLRVVETDVTAFYNWGTAPPAPG
FT                   TAYRFERLPSQQVVGARHDAIEGLARTALARVGMELNPAAPRYSVQVRIGTLVIERPTY
FT                   YGPGYDGFGFATPGVFLGGGNRGAAFGMSFPVYPMRFSDPYYRRELSLLVRDLTTSQVV
FT                   FETRAVNDGVQNETLAVLSAMLDAALQGFPQPPPGPRRITAQIPR"
     MKRALTAIFS IAFMGLFMAG CSGLRVVETD VTAFYNWGTA PPAPGTAYRF ERLPSQQVVG        60
     ARHDAIEGLA RTALARVGME LNPAAPRYSV QVRIGTLVIE RPTYYGPGYD GFGFATPGVF       120
     LGGGNRGAAF GMSFPVYPMR FSDPYYRREL SLLVRDLTTS QVVFETRAVN DGVQNETLAV       180
     LSAMLDAALQ GFPQPPPGPR RITAQIPR                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page