(data stored in ACNUC7421 zone)

EMBL: CP000529.PE51

CP000529.PE51        Location/Qualifiers
FT   CDS             52320..52619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35378"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA0"
FT                   /protein_id="ABM35378.1"
FT                   /translation="MQAHYAETFERDMGCTEAEWLGWLPAALGDHAWQRSGPSVQARIG
FT                   PGSLQIDWRPAAPRVLGSARIPRLLVRFAFAGLDDGQRHAFMKRFDVYMQRGGG"
     MQAHYAETFE RDMGCTEAEW LGWLPAALGD HAWQRSGPSV QARIGPGSLQ IDWRPAAPRV        60
     LGSARIPRLL VRFAFAGLDD GQRHAFMKRF DVYMQRGGG                               99
//

If you have problems or comments...

PBIL Back to PBIL home page