(data stored in ACNUC7421 zone)

EMBL: CP000529.PE510

CP000529.PE510       Location/Qualifiers
FT   CDS             complement(544596..545540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0516"
FT                   /product="tRNA s(2)C-32 sulfurtransferase"
FT                   /EC_number="2.8.1.4"
FT                   /note="PFAM: PP-loop domain protein; KEGG: pol:Bpro_4089
FT                   PP-loop"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35837"
FT                   /db_xref="GOA:A1VJK9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJK9"
FT                   /protein_id="ABM35837.1"
FT                   /translation="MNAIWIDEQLETSARVQNSMKIEREDHKLEKRLCREVGRAIVDFN
FT                   MIEEGDKVMVCVSGGKDSYAMLDILLKLQKRAPINFELVAVNLDQKQPGFPEHVLPEYL
FT                   SKLGVPYHIENQDTYSIVTRVIPEGKTLCSLCSRLRRGILYRVAGELGCTKIALGHHRD
FT                   DMLQTFFLNMFFAAKLKGMPPKLVSDDGKNIVIRPMAYVTEKDLTRWAQVQDFPIIPCT
FT                   LCGSQENLQRKQVGNMLRDWQKQYPGRIENMFSALQNIVPSHLMDSKRHDFKGIRTTGV
FT                   ADPEGDKAFDAEEFMQAAPAGRAVIGINPLAPG"
     MNAIWIDEQL ETSARVQNSM KIEREDHKLE KRLCREVGRA IVDFNMIEEG DKVMVCVSGG        60
     KDSYAMLDIL LKLQKRAPIN FELVAVNLDQ KQPGFPEHVL PEYLSKLGVP YHIENQDTYS       120
     IVTRVIPEGK TLCSLCSRLR RGILYRVAGE LGCTKIALGH HRDDMLQTFF LNMFFAAKLK       180
     GMPPKLVSDD GKNIVIRPMA YVTEKDLTRW AQVQDFPIIP CTLCGSQENL QRKQVGNMLR       240
     DWQKQYPGRI ENMFSALQNI VPSHLMDSKR HDFKGIRTTG VADPEGDKAF DAEEFMQAAP       300
     AGRAVIGINP LAPG                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page