(data stored in ACNUC7421 zone)

EMBL: CP000529.PE514

CP000529.PE514       Location/Qualifiers
FT   CDS             548057..548335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0616 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35841"
FT                   /db_xref="GOA:A1VJL3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL3"
FT                   /protein_id="ABM35841.1"
FT                   /translation="MLFTPATLSTLAHYLIVERKGQGLSRAQAAAVCNVSPSFIRDAES
FT                   DPARCSLGLLLQYMAGLGLLMDVAGWSHDVQAPIDFPGVVGDAEGNP"
     MLFTPATLST LAHYLIVERK GQGLSRAQAA AVCNVSPSFI RDAESDPARC SLGLLLQYMA        60
     GLGLLMDVAG WSHDVQAPID FPGVVGDAEG NP                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page