(data stored in ACNUC7421 zone)

EMBL: CP000529.PE515

CP000529.PE515       Location/Qualifiers
FT   CDS             548332..549600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0521"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: pol:Bpro_0617
FT                   HipA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35842"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL4"
FT                   /protein_id="ABM35842.1"
FT                   /translation="MIRLRVWANARPMGWFGHAAGEFFFEYDAQWLAQPGAYALAPQFV
FT                   LNAQTTRGALVRSFFENLLPEGEVLDDVLAALQLRGASSLDVLGRLGAELPGVLSLLPE
FT                   DSMPRIQQDYRDLPFAELSARLAHRTATPLLVSNTQAGMSLAGAQDKLGLRFEPRTRRL
FT                   YDSVGASPTTHILKPDTRQLRYQPSAINEYACMKLAQALKLPVPKVWLLRVPEAAYVVE
FT                   RYDRVLTAGNIVGLHQFDGCQLLGHGPGWKYERSGGLASLPKLVAALRALRVRGSDLLQ
FT                   FQRWVMFNYLIGNADAHAKNLSLLVDGKGYRLAPFYDLLCVRAYGDEGLALFIGDDETF
FT                   DAVGAHSWEAFCTDCGFGLAPTLVEFRRMALALLPAWGKVQTSVAKEKGVTEAERAMLA
FT                   RMSTIFERHAGHALSMTALPAPV"
     MIRLRVWANA RPMGWFGHAA GEFFFEYDAQ WLAQPGAYAL APQFVLNAQT TRGALVRSFF        60
     ENLLPEGEVL DDVLAALQLR GASSLDVLGR LGAELPGVLS LLPEDSMPRI QQDYRDLPFA       120
     ELSARLAHRT ATPLLVSNTQ AGMSLAGAQD KLGLRFEPRT RRLYDSVGAS PTTHILKPDT       180
     RQLRYQPSAI NEYACMKLAQ ALKLPVPKVW LLRVPEAAYV VERYDRVLTA GNIVGLHQFD       240
     GCQLLGHGPG WKYERSGGLA SLPKLVAALR ALRVRGSDLL QFQRWVMFNY LIGNADAHAK       300
     NLSLLVDGKG YRLAPFYDLL CVRAYGDEGL ALFIGDDETF DAVGAHSWEA FCTDCGFGLA       360
     PTLVEFRRMA LALLPAWGKV QTSVAKEKGV TEAERAMLAR MSTIFERHAG HALSMTALPA       420
     PV                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page