(data stored in ACNUC7421 zone)

EMBL: CP000529.PE516

CP000529.PE516       Location/Qualifiers
FT   CDS             549611..549805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35843"
FT                   /db_xref="GOA:A1VJL5"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL5"
FT                   /protein_id="ABM35843.1"
FT                   /translation="MIRWFIVIFLALVCISWLSPLLQKLGFGKLPGDLRFRLFGREWFI
FT                   PVTTTILLSFVASLVSQLI"
     MIRWFIVIFL ALVCISWLSP LLQKLGFGKL PGDLRFRLFG REWFIPVTTT ILLSFVASLV        60
     SQLI                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page