(data stored in ACNUC7421 zone)

EMBL: CP000529.PE517

CP000529.PE517       Location/Qualifiers
FT   CDS             549995..551251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0523"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: rfr:Rfer_1097 extracellular solute-binding
FT                   protein, family 1; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35844"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL6"
FT                   /protein_id="ABM35844.1"
FT                   /translation="MLKFSKLAAAAAFVAVAAAAMAGEVEVLHYWTSGGEAKSVDELKT
FT                   MMAGRGYTWKDFAVTGGGGENAMGMLKKRVLAGNPPAAALIKGPTIQEWANLNVLTNLD
FT                   TMAQFGKWDESLPKVIAEQMKYQGHYVAVPVNVHRVNWLWANSAVLKKAGVTALPKTYE
FT                   EFFAAADKLRAAGFIPLAHGGQDWQDFTVFESVALGVGGTAFYNKALVRLDEAALAGSE
FT                   MRKTLEVFRRLKPYTDDKSAGRDWNQATALVTAGKAGFQLMGDWAKGEFLAANQEPGKD
FT                   FTCTPAPGTAHAYSFNVDSFAMFQLKNGDARKAQGYLAFLLMGQNFQERFNLRKGSIPA
FT                   RLNMNLDKFDECARLSGQDFAAMSKTGALVPSVAHGMAVPPAVQSALRAAVSDFWNNDK
FT                   TTVNETLARLALAAGAPVK"
     MLKFSKLAAA AAFVAVAAAA MAGEVEVLHY WTSGGEAKSV DELKTMMAGR GYTWKDFAVT        60
     GGGGENAMGM LKKRVLAGNP PAAALIKGPT IQEWANLNVL TNLDTMAQFG KWDESLPKVI       120
     AEQMKYQGHY VAVPVNVHRV NWLWANSAVL KKAGVTALPK TYEEFFAAAD KLRAAGFIPL       180
     AHGGQDWQDF TVFESVALGV GGTAFYNKAL VRLDEAALAG SEMRKTLEVF RRLKPYTDDK       240
     SAGRDWNQAT ALVTAGKAGF QLMGDWAKGE FLAANQEPGK DFTCTPAPGT AHAYSFNVDS       300
     FAMFQLKNGD ARKAQGYLAF LLMGQNFQER FNLRKGSIPA RLNMNLDKFD ECARLSGQDF       360
     AAMSKTGALV PSVAHGMAVP PAVQSALRAA VSDFWNNDKT TVNETLARLA LAAGAPVK         418
//

If you have problems or comments...

PBIL Back to PBIL home page