(data stored in ACNUC7421 zone)

EMBL: CP000529.PE519

CP000529.PE519       Location/Qualifiers
FT   CDS             complement(552677..554497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0525"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   pol:Bpro_3916 glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35846"
FT                   /db_xref="GOA:A1VJL8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL8"
FT                   /protein_id="ABM35846.1"
FT                   /translation="MSAAVLAPNFAPPAPPSLSLGVIGNCAFSALVDARGRIVWCCLPR
FT                   FDGDPVFNALLDESDKGSAFAIEIENFSHSKQWYDPNTAVLRTQLFDKSGQAIEITDFA
FT                   PRFYNRSRFFKPMTLVRRVRPIKGAPRIRVQLDVRFDWGRSEPVITQGSNHLRYVGDAL
FT                   TLRLNTDAPLSHLLAKRPFVLTREYNFLLGSDESLADGIADTARLFEQETLSYWRKWSQ
FT                   RLHIPLEWQEAVIRAAITLKLSLFEDTGAIVAAMTTSIPEAPNSGRTWDYRFCWLRDAF
FT                   FVVRALNSLSEVGTMEDYLRWLGNVVVQADGGHIQPLFGIGLELELPEAVYDHLGGYRG
FT                   MGPVRVGNQAQEHFQHDVYGNVILGAAQAFHDHRLLHRAGAAEFLRLEAVGEQAVRSYD
FT                   KPDAGMWELRTRARVHTSSALMCWAACDRLGKIAVTLKQPERASYWSHHAQIMRERILR
FT                   ESWSEERQAFAESFGGRDLDASVLLMIEVGFIEPKDPRFVATVDALEKYLCDGPYMRRY
FT                   EAPDDFGKPETAFNICTFWRIDALARIGRKDEARAIFETMLAARNHVGLLSEDTHPVTG
FT                   EMWGNFPQTYSMVGIINAAVRLSAPWDSLV"
     MSAAVLAPNF APPAPPSLSL GVIGNCAFSA LVDARGRIVW CCLPRFDGDP VFNALLDESD        60
     KGSAFAIEIE NFSHSKQWYD PNTAVLRTQL FDKSGQAIEI TDFAPRFYNR SRFFKPMTLV       120
     RRVRPIKGAP RIRVQLDVRF DWGRSEPVIT QGSNHLRYVG DALTLRLNTD APLSHLLAKR       180
     PFVLTREYNF LLGSDESLAD GIADTARLFE QETLSYWRKW SQRLHIPLEW QEAVIRAAIT       240
     LKLSLFEDTG AIVAAMTTSI PEAPNSGRTW DYRFCWLRDA FFVVRALNSL SEVGTMEDYL       300
     RWLGNVVVQA DGGHIQPLFG IGLELELPEA VYDHLGGYRG MGPVRVGNQA QEHFQHDVYG       360
     NVILGAAQAF HDHRLLHRAG AAEFLRLEAV GEQAVRSYDK PDAGMWELRT RARVHTSSAL       420
     MCWAACDRLG KIAVTLKQPE RASYWSHHAQ IMRERILRES WSEERQAFAE SFGGRDLDAS       480
     VLLMIEVGFI EPKDPRFVAT VDALEKYLCD GPYMRRYEAP DDFGKPETAF NICTFWRIDA       540
     LARIGRKDEA RAIFETMLAA RNHVGLLSED THPVTGEMWG NFPQTYSMVG IINAAVRLSA       600
     PWDSLV                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page