(data stored in ACNUC7421 zone)

EMBL: CP000529.PE523

CP000529.PE523       Location/Qualifiers
FT   CDS             complement(558214..559257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0529"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rfr:Rfer_1086 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35850"
FT                   /db_xref="GOA:A1VJM2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJM2"
FT                   /protein_id="ABM35850.1"
FT                   /translation="MKSRYAIHAFSALISRPLPSIPMQHPHPHLRSRPIAAGQLRAFEA
FT                   VARHLNFRAASEELSLTQSAVSRQIQSLEEDVGVSLFLRHTRAVELTSAGAQLLRAVLP
FT                   SLERIDGVVRMIRQSAGRKSVAISTWASFASMWLIPRLEAFQREHPDIDIRIDATDTPV
FT                   DLETTDVDLALRYSMPASVPAQARRLFGEQLTPVISPWLLKSGPRLQNAQDLARFALVE
FT                   ASDAHRTQHMEWLSWQRWFDMQGLRRFEPKRWLYFNYAHQIAQAALTGQGVALARMPLI
FT                   AESLASGDLVEVLPDRRMDSPMAYWLIVGPRNAARPEVQAFCSWIEAQAAQTREAIGDV
FT                   PPAAPAR"
     MKSRYAIHAF SALISRPLPS IPMQHPHPHL RSRPIAAGQL RAFEAVARHL NFRAASEELS        60
     LTQSAVSRQI QSLEEDVGVS LFLRHTRAVE LTSAGAQLLR AVLPSLERID GVVRMIRQSA       120
     GRKSVAISTW ASFASMWLIP RLEAFQREHP DIDIRIDATD TPVDLETTDV DLALRYSMPA       180
     SVPAQARRLF GEQLTPVISP WLLKSGPRLQ NAQDLARFAL VEASDAHRTQ HMEWLSWQRW       240
     FDMQGLRRFE PKRWLYFNYA HQIAQAALTG QGVALARMPL IAESLASGDL VEVLPDRRMD       300
     SPMAYWLIVG PRNAARPEVQ AFCSWIEAQA AQTREAIGDV PPAAPAR                     347
//

If you have problems or comments...

PBIL Back to PBIL home page