(data stored in ACNUC7421 zone)

EMBL: CP000529.PE528

CP000529.PE528       Location/Qualifiers
FT   CDS             complement(563289..563771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0535"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   pol:Bpro_0674 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35855"
FT                   /db_xref="GOA:A1VJM7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJM7"
FT                   /protein_id="ABM35855.1"
FT                   /translation="MEQNYADATDIRLLELLQTDASLSNQALAERVHISPPTCLRRVKR
FT                   LRDAGLIEREIAVLSPDKLAGVLGYGLSAVVEISLDQQGAEWLEAFEARVVADDAVQQC
FT                   YRVSPGPDFILLVHVADMPGYQALAQRLFTSNANVRNVKAFFSIKRAKFQPKVMLA"
     MEQNYADATD IRLLELLQTD ASLSNQALAE RVHISPPTCL RRVKRLRDAG LIEREIAVLS        60
     PDKLAGVLGY GLSAVVEISL DQQGAEWLEA FEARVVADDA VQQCYRVSPG PDFILLVHVA       120
     DMPGYQALAQ RLFTSNANVR NVKAFFSIKR AKFQPKVMLA                             160
//

If you have problems or comments...

PBIL Back to PBIL home page