(data stored in ACNUC7421 zone)

EMBL: CP000529.PE53

CP000529.PE53        Location/Qualifiers
FT   CDS             54110..55105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spn:SP1772 cell wall surface anchor family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35380"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA2"
FT                   /protein_id="ABM35380.1"
FT                   /translation="MRHVLTLAAASAMLVACGGGSDSAPAATPTPAATQATLTSANYVA
FT                   VAQESLSSSAYLANTTGLVTGAQVSDSEALIRFGQDQLPKLPRWLADAPVQAVGAVQSQ
FT                   TENCAGGGTLTISANDANGNRLVDAGDSVSLTANNCSFEGQLLNGQLTLTINSLTGNPD
FT                   HYPYSLSVTLGFNNLATQSASLRTVGNGSLALSIDARAANDQSLVLRTSSLNLSSTYGT
FT                   TTYSKTLTGYATSVELRPAGTGFTSTTSVDGTLSSSAFESRSISIATPVSFVRTSGQTY
FT                   PSSGQLVITGAAGGKIRVTVTSATTVLIELDADANGSYEASTSKLWSDML"
     MRHVLTLAAA SAMLVACGGG SDSAPAATPT PAATQATLTS ANYVAVAQES LSSSAYLANT        60
     TGLVTGAQVS DSEALIRFGQ DQLPKLPRWL ADAPVQAVGA VQSQTENCAG GGTLTISAND       120
     ANGNRLVDAG DSVSLTANNC SFEGQLLNGQ LTLTINSLTG NPDHYPYSLS VTLGFNNLAT       180
     QSASLRTVGN GSLALSIDAR AANDQSLVLR TSSLNLSSTY GTTTYSKTLT GYATSVELRP       240
     AGTGFTSTTS VDGTLSSSAF ESRSISIATP VSFVRTSGQT YPSSGQLVIT GAAGGKIRVT       300
     VTSATTVLIE LDADANGSYE ASTSKLWSDM L                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page