(data stored in ACNUC7421 zone)

EMBL: CP000529.PE530

CP000529.PE530       Location/Qualifiers
FT   CDS             complement(565874..566455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0537"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   sal:Sala_0677 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35857"
FT                   /db_xref="GOA:A1VJM9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJM9"
FT                   /protein_id="ABM35857.1"
FT                   /translation="MECGLPVLRLLVQQRALRAPFPGRAAATRHGRGDGRFDLLPGASS
FT                   FGRRPQNQRPAGHRHHARGPELPKIHAVCDALGNPLRFVLTPGQRHDSKPVPELLDGLQ
FT                   AKAPLADKAYDSDKIVQAAEKRGMQVIIPSRVNREKQRVLDKHRYKTRHLIENLFQRMK
FT                   AFRRVATRFDKLDIRSLGFVHIAGIMKWLH"
     MECGLPVLRL LVQQRALRAP FPGRAAATRH GRGDGRFDLL PGASSFGRRP QNQRPAGHRH        60
     HARGPELPKI HAVCDALGNP LRFVLTPGQR HDSKPVPELL DGLQAKAPLA DKAYDSDKIV       120
     QAAEKRGMQV IIPSRVNREK QRVLDKHRYK TRHLIENLFQ RMKAFRRVAT RFDKLDIRSL       180
     GFVHIAGIMK WLH                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page