(data stored in ACNUC7421 zone)

EMBL: CP000529.PE539

CP000529.PE539       Location/Qualifiers
FT   CDS             575351..576088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0546"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_6521 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35866"
FT                   /db_xref="GOA:A1VJN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN8"
FT                   /protein_id="ABM35866.1"
FT                   /translation="MSTALLDIEVRRKTFGDATVLQGIRLQISAGEIVSLVGASGCGKS
FT                   TLLRIVAGLETAYQGRITLGGQPLAGLSRDVGFIFQEPRLFPWLSVAQNVAFSAGAQGA
FT                   RDPRVAQLLAEVGLAGLTDALPKQLSGGQAQRVAIARGLFGQPRLLLLDEPFSAVDAFT
FT                   RMHLQDMLLDIARRHGTTLLLVTHDIDEAVYLADRVWVLDSKPGRLSADMAIDLPQPRQ
FT                   RDTEALAQRRIGVLHALQAVHAI"
     MSTALLDIEV RRKTFGDATV LQGIRLQISA GEIVSLVGAS GCGKSTLLRI VAGLETAYQG        60
     RITLGGQPLA GLSRDVGFIF QEPRLFPWLS VAQNVAFSAG AQGARDPRVA QLLAEVGLAG       120
     LTDALPKQLS GGQAQRVAIA RGLFGQPRLL LLDEPFSAVD AFTRMHLQDM LLDIARRHGT       180
     TLLLVTHDID EAVYLADRVW VLDSKPGRLS ADMAIDLPQP RQRDTEALAQ RRIGVLHALQ       240
     AVHAI                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page