(data stored in ACNUC7421 zone)

EMBL: CP000529.PE540

CP000529.PE540       Location/Qualifiers
FT   CDS             576594..577703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0547"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: bacterial
FT                   luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35867"
FT                   /db_xref="GOA:A1VJN9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR024014"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN9"
FT                   /protein_id="ABM35867.1"
FT                   /translation="MSQEQIKFAYWVPNVSGGLVVSKIEQRTSWNIDYNRKLAQTAEKA
FT                   GFEYALSQIRFTAGYGAEFQHESVAISHALLAATDKLRVIAAILPGPWNPVVLAKQIAT
FT                   IDHLTNGRVAVNIVSGWFRGEFQAIGEPWLEHDERYRRSEEFIEVLKGIWTTDNFSYQG
FT                   DFYRIHNYSLKPKPLQQAPHPEIFQGGSSRAARDMASRVSDWYFTNGNTVEGIQAQVDD
FT                   IRAKAAANGHSVKVGVNAFIIARDTEQEARAVLAEIIEKADPEAVNAFGHEVKQAGKAS
FT                   PEGEGNWAKSTFEDLVQYNDGFKTNLIGTPQQIAERIVALKAVGVDLILSGFLHFQEEV
FT                   AYFGDKVLPLVRELERELQAEPVPLKLAA"
     MSQEQIKFAY WVPNVSGGLV VSKIEQRTSW NIDYNRKLAQ TAEKAGFEYA LSQIRFTAGY        60
     GAEFQHESVA ISHALLAATD KLRVIAAILP GPWNPVVLAK QIATIDHLTN GRVAVNIVSG       120
     WFRGEFQAIG EPWLEHDERY RRSEEFIEVL KGIWTTDNFS YQGDFYRIHN YSLKPKPLQQ       180
     APHPEIFQGG SSRAARDMAS RVSDWYFTNG NTVEGIQAQV DDIRAKAAAN GHSVKVGVNA       240
     FIIARDTEQE ARAVLAEIIE KADPEAVNAF GHEVKQAGKA SPEGEGNWAK STFEDLVQYN       300
     DGFKTNLIGT PQQIAERIVA LKAVGVDLIL SGFLHFQEEV AYFGDKVLPL VRELERELQA       360
     EPVPLKLAA                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page