(data stored in ACNUC7421 zone)

EMBL: CP000529.PE541

CP000529.PE541       Location/Qualifiers
FT   CDS             577720..578931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0548"
FT                   /product="long-chain-fatty-acid--CoA ligase-related
FT                   protein"
FT                   /note="KEGG: long-chain-fatty-acid--CoA ligase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35868"
FT                   /db_xref="GOA:A1VJP0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP0"
FT                   /protein_id="ABM35868.1"
FT                   /translation="MTQTVNAASAAPATLPHWLLCQSHQQAGRIALRHKRLGVWQQRSW
FT                   RQAADEVHRLATALRASGFAEGSTLAILSRPRPEALLAALAAQWLGGVAALLDPLEAAA
FT                   GQIALLRALQPQAVFAEGLQEIERLQTSALTSGLVLYADGRGVTSPNPAGLALADYAQL
FT                   ALRETDCPWPVQAHAERTAFAFYRHAASGQIEQQRITHAELLQQGRRLVLAEKLGADEE
FT                   ALAARAFAASGQARYLLAPWLIAGFCLNFPENLATRDNDRRELGPTLVAGTLETYTRLH
FT                   ELVQSRLPQPGSVQRRLVDWALTAQPGAARRVLGEWLVRRPLRDVIGFTRTRAPLLVGE
FT                   PLSNNAQAFFAALGIEVRAWPDPAQWHSPAVAPAVPVPPTAPATPSLTTRQPGGWNPHG
FT                   AQAA"
     MTQTVNAASA APATLPHWLL CQSHQQAGRI ALRHKRLGVW QQRSWRQAAD EVHRLATALR        60
     ASGFAEGSTL AILSRPRPEA LLAALAAQWL GGVAALLDPL EAAAGQIALL RALQPQAVFA       120
     EGLQEIERLQ TSALTSGLVL YADGRGVTSP NPAGLALADY AQLALRETDC PWPVQAHAER       180
     TAFAFYRHAA SGQIEQQRIT HAELLQQGRR LVLAEKLGAD EEALAARAFA ASGQARYLLA       240
     PWLIAGFCLN FPENLATRDN DRRELGPTLV AGTLETYTRL HELVQSRLPQ PGSVQRRLVD       300
     WALTAQPGAA RRVLGEWLVR RPLRDVIGFT RTRAPLLVGE PLSNNAQAFF AALGIEVRAW       360
     PDPAQWHSPA VAPAVPVPPT APATPSLTTR QPGGWNPHGA QAA                         403
//

If you have problems or comments...

PBIL Back to PBIL home page