(data stored in ACNUC7421 zone)

EMBL: CP000529.PE545

CP000529.PE545       Location/Qualifiers
FT   CDS             581780..583105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0552"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: ppu:PP_2770 hypothetical protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35872"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP4"
FT                   /protein_id="ABM35872.1"
FT                   /translation="MFKPTFARSLVLALSLAAAAVTAQAEPEQYFPLQSYRVGPYAAGG
FT                   TGFFGGFIDYMQYVNANGGVNGVKLTWSECETEYVVEKGVECYERLKKGLNGAPAAATN
FT                   PLSVGIAYATLDRSTADKLPLITINHGRTDSTDGSVFPYAFPLQLNPYSEVSAIVNYIG
FT                   KQAGGLDKLKGQKIVTLYHGSPYGKETIPVLDLLAKKYGFTVEHVEVPHPGNEQQSQWL
FT                   NIRRAKPDWVILRGWGVMNPVALKTAQKVGFPANRIIGNIWSNSEDDAAPAGAAAKGFI
FT                   SITTHPSGTEFPVLKGIKKQVVDAGKGNLADPKRFGSVYYNLGVVNGILNIEALRIAQD
FT                   KFGKKPLSGEQVRWGFENLKLDDARLKSLGALGLVQPLKLSCADHEGGGAVRFQQWDGQ
FT                   KWSVISDWVQADRALLRPIIEESARKYAKEKGITPRDCGKEG"
     MFKPTFARSL VLALSLAAAA VTAQAEPEQY FPLQSYRVGP YAAGGTGFFG GFIDYMQYVN        60
     ANGGVNGVKL TWSECETEYV VEKGVECYER LKKGLNGAPA AATNPLSVGI AYATLDRSTA       120
     DKLPLITINH GRTDSTDGSV FPYAFPLQLN PYSEVSAIVN YIGKQAGGLD KLKGQKIVTL       180
     YHGSPYGKET IPVLDLLAKK YGFTVEHVEV PHPGNEQQSQ WLNIRRAKPD WVILRGWGVM       240
     NPVALKTAQK VGFPANRIIG NIWSNSEDDA APAGAAAKGF ISITTHPSGT EFPVLKGIKK       300
     QVVDAGKGNL ADPKRFGSVY YNLGVVNGIL NIEALRIAQD KFGKKPLSGE QVRWGFENLK       360
     LDDARLKSLG ALGLVQPLKL SCADHEGGGA VRFQQWDGQK WSVISDWVQA DRALLRPIIE       420
     ESARKYAKEK GITPRDCGKE G                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page