(data stored in ACNUC7421 zone)

EMBL: CP000529.PE547

CP000529.PE547       Location/Qualifiers
FT   CDS             584498..585751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0554"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal domain
FT                   protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   atc:AGR_pAT_773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35874"
FT                   /db_xref="GOA:A1VJP6"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP6"
FT                   /protein_id="ABM35874.1"
FT                   /translation="MTATATLERPRVNSPAPFAPRPRPVKAAHLIRSDAEAIEIAHRLA
FT                   ARFAPESALRDREGFLPIDEIDAYSQSGLWGINVPKAYGGPGVSYATLAEVVAIISAAD
FT                   SSIAQISQNHFVLVAHVGLDASEAQKQELFGLVLQGHRFGNAFSELNSRNVAAFETKVV
FT                   VHGDEVEVNGQKFYTTGALLSHIVPIVAVNEAGKGYIVFADRDTPGLTVINDWSGFGQR
FT                   TTASGSVKIERVRVPQSRVVPIDAFDHPSAAGPISQIIQAAIDAGIARGALADSIDFIR
FT                   SKSRPWIDSGKETAGEDPFTIAAIGDLQIRLHAAEALLERAGRLVDAALANATEATVAA
FT                   ATVGTAEAKVLTTQVAIEVTNRLFELAGTRSALTVHNLDRHWRNARIHTLHDPVRWKFF
FT                   HIGNYYLNGVNPPRHPWN"
     MTATATLERP RVNSPAPFAP RPRPVKAAHL IRSDAEAIEI AHRLAARFAP ESALRDREGF        60
     LPIDEIDAYS QSGLWGINVP KAYGGPGVSY ATLAEVVAII SAADSSIAQI SQNHFVLVAH       120
     VGLDASEAQK QELFGLVLQG HRFGNAFSEL NSRNVAAFET KVVVHGDEVE VNGQKFYTTG       180
     ALLSHIVPIV AVNEAGKGYI VFADRDTPGL TVINDWSGFG QRTTASGSVK IERVRVPQSR       240
     VVPIDAFDHP SAAGPISQII QAAIDAGIAR GALADSIDFI RSKSRPWIDS GKETAGEDPF       300
     TIAAIGDLQI RLHAAEALLE RAGRLVDAAL ANATEATVAA ATVGTAEAKV LTTQVAIEVT       360
     NRLFELAGTR SALTVHNLDR HWRNARIHTL HDPVRWKFFH IGNYYLNGVN PPRHPWN          417
//

If you have problems or comments...

PBIL Back to PBIL home page