(data stored in ACNUC7421 zone)

EMBL: CP000529.PE548

CP000529.PE548       Location/Qualifiers
FT   CDS             586010..586771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0555"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: branched-chain amino acid ABC transporter,
FT                   ATP-binding protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35875"
FT                   /db_xref="GOA:A1VJP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP7"
FT                   /protein_id="ABM35875.1"
FT                   /translation="MPSHPILQIDDIEVVYEQVILALRGVSLSVRAGQIVALLGANGAG
FT                   KSTTLKAVSHLIRAERGDLTRGRILYRGEDIGQHDPDALVAGGLVQVLEGRHCFAHLTV
FT                   EDNLLIGAFVRKVSRRAMQADLERIYGYFPRLRLRRKSLAGYTSGGEQQMVAIGRALMA
FT                   KPRLVLLDEPSMGLAPQIVEEIFDIIARLNRDEGVSFLLAEQNISIALRYAQYAYVLES
FT                   GRVVSQGQAQELAQREDMRDFYLGGQVAIAA"
     MPSHPILQID DIEVVYEQVI LALRGVSLSV RAGQIVALLG ANGAGKSTTL KAVSHLIRAE        60
     RGDLTRGRIL YRGEDIGQHD PDALVAGGLV QVLEGRHCFA HLTVEDNLLI GAFVRKVSRR       120
     AMQADLERIY GYFPRLRLRR KSLAGYTSGG EQQMVAIGRA LMAKPRLVLL DEPSMGLAPQ       180
     IVEEIFDIIA RLNRDEGVSF LLAEQNISIA LRYAQYAYVL ESGRVVSQGQ AQELAQREDM       240
     RDFYLGGQVA IAA                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page