(data stored in ACNUC7421 zone)

EMBL: CP000529.PE554

CP000529.PE554       Location/Qualifiers
FT   CDS             591711..592562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0561"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bbr:BB1077
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35881"
FT                   /db_xref="GOA:A1VJQ3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ3"
FT                   /protein_id="ABM35881.1"
FT                   /translation="MKVIDLRCRPAYLHDFFGANPGSPGYETARWLNRRVGTRGSDEHF
FT                   ARSLTPEGFLAEVRDAGLSKAVVVGRNTPAQHLPNDLIHQITHAHEELLGIAGIDPALQ
FT                   GVDGALAEIDRAIDQLGLAGIGLEPGFGAPARHPDDALYFPVYEHLNRRGLPLFLMSGP
FT                   TTPDPAFNDPGRLAKVAQAFPQLRIVCYHGYYPNTQQLVGVAFRYENISVVPDMYQFLP
FT                   GSEVFVQAANGFMGDQLLFGSSYPFRPIRQSIDDFLALGFRGKVLDKLLYGNAARLFGL
FT                   AA"
     MKVIDLRCRP AYLHDFFGAN PGSPGYETAR WLNRRVGTRG SDEHFARSLT PEGFLAEVRD        60
     AGLSKAVVVG RNTPAQHLPN DLIHQITHAH EELLGIAGID PALQGVDGAL AEIDRAIDQL       120
     GLAGIGLEPG FGAPARHPDD ALYFPVYEHL NRRGLPLFLM SGPTTPDPAF NDPGRLAKVA       180
     QAFPQLRIVC YHGYYPNTQQ LVGVAFRYEN ISVVPDMYQF LPGSEVFVQA ANGFMGDQLL       240
     FGSSYPFRPI RQSIDDFLAL GFRGKVLDKL LYGNAARLFG LAA                         283
//

If you have problems or comments...

PBIL Back to PBIL home page