(data stored in ACNUC7421 zone)

EMBL: CP000529.PE557

CP000529.PE557       Location/Qualifiers
FT   CDS             594770..595945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0564"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase;
FT                   KEGG: pfo:Pfl_3918 sigma-54 specific transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35884"
FT                   /db_xref="GOA:A1VJQ6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ6"
FT                   /protein_id="ABM35884.1"
FT                   /translation="MNQLLTFPDAGKHALSIRAKALVFEDPQSQALLARLDQVAPTEAT
FT                   VVIIGETGTGKELLARRIHQGSARRGPFVAVNCGAFSESLIDAELFGHESGAFTGASQA
FT                   RAGWFEAANGGSLFLDEIGDLPLALQVKLLRVLQERQIVRIGSRKPIELDVRLIAATNV
FT                   DLRDAVNAGHFRADLYYRLSVATLELRPLWERPGDILPLARHFLASYAKRLGIEGSTLT
FT                   PGAEQALLAHDWPGNIRELENVVHYALIVAPAAAIHASDLQSIQRSARSRARQPVALPP
FT                   AVADSSASTPEVAAVPTLRQMLRELLLKSMKLNQPLLFEQVQATLVCTAFEFCHNNQVQ
FT                   TARLLGLSRNVLRTLLKQHGLLAAHEDSSPDTGDFAADLLVGQPVAASSMA"
     MNQLLTFPDA GKHALSIRAK ALVFEDPQSQ ALLARLDQVA PTEATVVIIG ETGTGKELLA        60
     RRIHQGSARR GPFVAVNCGA FSESLIDAEL FGHESGAFTG ASQARAGWFE AANGGSLFLD       120
     EIGDLPLALQ VKLLRVLQER QIVRIGSRKP IELDVRLIAA TNVDLRDAVN AGHFRADLYY       180
     RLSVATLELR PLWERPGDIL PLARHFLASY AKRLGIEGST LTPGAEQALL AHDWPGNIRE       240
     LENVVHYALI VAPAAAIHAS DLQSIQRSAR SRARQPVALP PAVADSSAST PEVAAVPTLR       300
     QMLRELLLKS MKLNQPLLFE QVQATLVCTA FEFCHNNQVQ TARLLGLSRN VLRTLLKQHG       360
     LLAAHEDSSP DTGDFAADLL VGQPVAASSM A                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page