(data stored in ACNUC7421 zone)

EMBL: CP000529.PE559

CP000529.PE559       Location/Qualifiers
FT   CDS             complement(598299..599864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0566"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: rso:RS02156 putative outer membrane drug
FT                   efflux lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35886"
FT                   /db_xref="GOA:A1VJQ8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ8"
FT                   /protein_id="ABM35886.1"
FT                   /translation="MRHQQMEVGGEVGEVGRGQRGRQHCQGRWRLRLSWAGCTGLMALA
FT                   LAACGSVAPPPVALSEAPPAWQTPADLAAAQGAAPWRPAQPGDSLDKGAWWRLFNDPGL
FT                   DALQQQARQASPSLQVAAARLRQAHTLVDIAGASSLPRVDAGLRGTRTGTSANRPAATA
FT                   GAQASASVQNDFVLSSTVSYELDLFGRQRHEQQAALAFEQQAQADQLNAQLVLSADLAA
FT                   FYFTLRSLDAEIAVVEQGLQVQGRAADLLAARHEGGAASGLDRAQQQAQFDATRTQLTL
FT                   LRKQRGQLEHALATLVGTPASQFTLPVAALPAGVPGLPVALPSEVLQRRPDIAAAERAV
FT                   AVANAQLGLAKAAWFPSLTLSASGGWEAKNIASLIDAPSLLWALGGSLTQAVFDGGRLR
FT                   AREEQARAGQELAAASYRQVVLRALQEVEDGLLALNALASAQSQSQAASASAQRVLDIA
FT                   QDRYAGGLSTYLDVVTAQQNVLTNQRLSSQLRGQQLQATAYLVKALGGGWQPGELEQAL
FT                   LGQR"
     MRHQQMEVGG EVGEVGRGQR GRQHCQGRWR LRLSWAGCTG LMALALAACG SVAPPPVALS        60
     EAPPAWQTPA DLAAAQGAAP WRPAQPGDSL DKGAWWRLFN DPGLDALQQQ ARQASPSLQV       120
     AAARLRQAHT LVDIAGASSL PRVDAGLRGT RTGTSANRPA ATAGAQASAS VQNDFVLSST       180
     VSYELDLFGR QRHEQQAALA FEQQAQADQL NAQLVLSADL AAFYFTLRSL DAEIAVVEQG       240
     LQVQGRAADL LAARHEGGAA SGLDRAQQQA QFDATRTQLT LLRKQRGQLE HALATLVGTP       300
     ASQFTLPVAA LPAGVPGLPV ALPSEVLQRR PDIAAAERAV AVANAQLGLA KAAWFPSLTL       360
     SASGGWEAKN IASLIDAPSL LWALGGSLTQ AVFDGGRLRA REEQARAGQE LAAASYRQVV       420
     LRALQEVEDG LLALNALASA QSQSQAASAS AQRVLDIAQD RYAGGLSTYL DVVTAQQNVL       480
     TNQRLSSQLR GQQLQATAYL VKALGGGWQP GELEQALLGQ R                           521
//

If you have problems or comments...

PBIL Back to PBIL home page