(data stored in ACNUC7421 zone)

EMBL: CP000529.PE561

CP000529.PE561       Location/Qualifiers
FT   CDS             complement(601160..604357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0568"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   rso:RS02154 probable transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35888"
FT                   /db_xref="GOA:A1VJR0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR0"
FT                   /protein_id="ABM35888.1"
FT                   /translation="MWIVQVALRRPYTFIVAALLILLATPFVLRKTPVDVFPEINIPVV
FT                   AILVSYNGLSAEEMTNRIVTPIERNLANSVSDMEHTESQTLGGVGVIKVFFQPQVDQAA
FT                   AIAQVVASTQASLRSLPAGAQPPTIIKYSATDLPILQLGFSSPARSVQELNEQAFNVLR
FT                   TKLITIPGTAVTAPYGGRFRQISIDINGPALAARGLSAIDVVNALQVQNLMLPSGTAKI
FT                   GGQEIAIALNGSPASIAELGDIPITTVNGATVYVRDVAQVRDGAQAQTNIVRSGGERGL
FT                   LMTVLKNGGASTLDIIDTIKAKLPKALLALPEDITVTPLADQSVFVAAAIKSVVHEALI
FT                   AGALTAALLLLFLGNWRSTAIIAISIPLSILCSLITLHLIGQSINIMTLGGLALAVGIL
FT                   VDDATVEIENVERHLHLGKTPHQAILDGAAEIATPALVATGCICIAFVPLFFLPGVAGK
FT                   LFMPLAQAVVFAMAASYILSRTLVPTLVMYLMRHQSRHAGEGHHQPGRFRRIHLAFDAW
FT                   FERFRHGYSVVLAALLQRKALFGSGFMAFALLSSGLYTALGRDFFPTVDAGQIRLHVRA
FT                   PAGISLDEMPPFVDKVERRIREVVGAAEVASIVDIVGGPYTPYNMVYNNNGTIDSSDVE
FT                   IMVALTPDHQPTQGHIRALRETLARDFPGNEFYFQSADMVSQTLNFGLSAPIDIQIQGA
FT                   KTAENLAVAATLLNQIRQVPGAVDTLLYQRFNRRALQLDMDRSRLAQTGLVARDVAQNV
FT                   MVSLSSSFQTSPTYWMNPANGSVYNVAVQVPQYDIDSLGAMLGIPVNAPGSNGQPREPQ
FT                   LLGNVVSVKSASQQANVSHYNIAPVIDLYASVDGRDLASTYADIEKLIVKAREKLPRGS
FT                   EITVRGQIETLRTAFSSLIWGLALAIVLVYLLLVVNFQSWLDALIIVSGLPAALAGIAW
FT                   MLYLTGTPLSVPALTGAIMTVGVATANSILVVSFARQRLAEGVPALTAALEAGSTRLRP
FT                   VLMTALAMVIGMVPMAIGLGEGGEQNAPLGRAVIGGLLFATLSTLVLVPLVFAGVHRRL
FT                   SARVRLPGAAPVEPVPA"
     MWIVQVALRR PYTFIVAALL ILLATPFVLR KTPVDVFPEI NIPVVAILVS YNGLSAEEMT        60
     NRIVTPIERN LANSVSDMEH TESQTLGGVG VIKVFFQPQV DQAAAIAQVV ASTQASLRSL       120
     PAGAQPPTII KYSATDLPIL QLGFSSPARS VQELNEQAFN VLRTKLITIP GTAVTAPYGG       180
     RFRQISIDIN GPALAARGLS AIDVVNALQV QNLMLPSGTA KIGGQEIAIA LNGSPASIAE       240
     LGDIPITTVN GATVYVRDVA QVRDGAQAQT NIVRSGGERG LLMTVLKNGG ASTLDIIDTI       300
     KAKLPKALLA LPEDITVTPL ADQSVFVAAA IKSVVHEALI AGALTAALLL LFLGNWRSTA       360
     IIAISIPLSI LCSLITLHLI GQSINIMTLG GLALAVGILV DDATVEIENV ERHLHLGKTP       420
     HQAILDGAAE IATPALVATG CICIAFVPLF FLPGVAGKLF MPLAQAVVFA MAASYILSRT       480
     LVPTLVMYLM RHQSRHAGEG HHQPGRFRRI HLAFDAWFER FRHGYSVVLA ALLQRKALFG       540
     SGFMAFALLS SGLYTALGRD FFPTVDAGQI RLHVRAPAGI SLDEMPPFVD KVERRIREVV       600
     GAAEVASIVD IVGGPYTPYN MVYNNNGTID SSDVEIMVAL TPDHQPTQGH IRALRETLAR       660
     DFPGNEFYFQ SADMVSQTLN FGLSAPIDIQ IQGAKTAENL AVAATLLNQI RQVPGAVDTL       720
     LYQRFNRRAL QLDMDRSRLA QTGLVARDVA QNVMVSLSSS FQTSPTYWMN PANGSVYNVA       780
     VQVPQYDIDS LGAMLGIPVN APGSNGQPRE PQLLGNVVSV KSASQQANVS HYNIAPVIDL       840
     YASVDGRDLA STYADIEKLI VKAREKLPRG SEITVRGQIE TLRTAFSSLI WGLALAIVLV       900
     YLLLVVNFQS WLDALIIVSG LPAALAGIAW MLYLTGTPLS VPALTGAIMT VGVATANSIL       960
     VVSFARQRLA EGVPALTAAL EAGSTRLRPV LMTALAMVIG MVPMAIGLGE GGEQNAPLGR      1020
     AVIGGLLFAT LSTLVLVPLV FAGVHRRLSA RVRLPGAAPV EPVPA                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page