(data stored in ACNUC7421 zone)

EMBL: CP000529.PE563

CP000529.PE563       Location/Qualifiers
FT   CDS             complement(605150..606154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0570"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: rba:RB1022 gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35890"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR2"
FT                   /protein_id="ABM35890.1"
FT                   /translation="MTTKNILGRALLAASVAGVFASAAAQAQSPAPSGAVTPAIAGVVA
FT                   AGTPIELIKEGFHGTEGPVALPDGSLIFTETTANRVTRIAPDGATSTFVEGSNGANGLG
FT                   FTANGDLYAVQVLKARVGIIFPTTKARTLADNFEGAPFGRPNDLVVDSRGNVYFTDSGA
FT                   NPPVAGQPAPPVQATAPAKPAVYRISAKGELKRLAADIERPNGIQLSPDEKVLYVANTL
FT                   GEHLLAYDIAPDGALGPRRNFAKLEGWQKTDTGNSSGADGLAVDEAGRVYVASNKGIEV
FT                   FSSQGEALGSIALPKKPQNLAFAGERKKTLYAVGRGAAYRLPVLTAGYAGRAK"
     MTTKNILGRA LLAASVAGVF ASAAAQAQSP APSGAVTPAI AGVVAAGTPI ELIKEGFHGT        60
     EGPVALPDGS LIFTETTANR VTRIAPDGAT STFVEGSNGA NGLGFTANGD LYAVQVLKAR       120
     VGIIFPTTKA RTLADNFEGA PFGRPNDLVV DSRGNVYFTD SGANPPVAGQ PAPPVQATAP       180
     AKPAVYRISA KGELKRLAAD IERPNGIQLS PDEKVLYVAN TLGEHLLAYD IAPDGALGPR       240
     RNFAKLEGWQ KTDTGNSSGA DGLAVDEAGR VYVASNKGIE VFSSQGEALG SIALPKKPQN       300
     LAFAGERKKT LYAVGRGAAY RLPVLTAGYA GRAK                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page