(data stored in ACNUC7421 zone)

EMBL: CP000529.PE567

CP000529.PE567       Location/Qualifiers
FT   CDS             complement(607966..609417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0574"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="PFAM: protein of unknown function DUF1501; KEGG:
FT                   sus:Acid_1146 protein of unknown function DUF1501"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35894"
FT                   /db_xref="GOA:A1VJR6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR6"
FT                   /protein_id="ABM35894.1"
FT                   /translation="MNNDSRRDFLRKSGVYLGGAAAMSGVIPGLGSFSAAHAADLVDPL
FT                   ALKGPHFPGKIKSVIWLHQDGAPSTLDLYDYKPELIKLAGKEVPASFLKGIKTSTQGGV
FT                   GKLYASKREWKQHGQSGAWFSDLLPNLAKQADHMTFIKSSVTVGATHDISILKLNTGDL
FT                   NPGRPSLGAWITYALGSANKDLPPYVVLYNGDREPQAGSVNWSSGFLPAVYQGTAFRPG
FT                   DSPILYLDRPELRTAQQQRKSLDLLKRLNSAGAERYPSDSELRARIQSYELADRMQAAA
FT                   PAAVDISKESAATKEMYGLNDKTSQSYGEVLLRARRLVENGVRFVQVVSAVPQSLDSER
FT                   RNWDAHDELEQNHGLLSKMVDKPIAGLLADLKSRGLLDSTLVVWASEFGRTSWGESGSG
FT                   RDHNPWGYTQWMAGGGLKAGFTYGETDEIGLQTADKDKAMDTYDLHATILHLMGLDHLK
FT                   TTFLNNGRSERPTVVYGKVVKDLLA"
     MNNDSRRDFL RKSGVYLGGA AAMSGVIPGL GSFSAAHAAD LVDPLALKGP HFPGKIKSVI        60
     WLHQDGAPST LDLYDYKPEL IKLAGKEVPA SFLKGIKTST QGGVGKLYAS KREWKQHGQS       120
     GAWFSDLLPN LAKQADHMTF IKSSVTVGAT HDISILKLNT GDLNPGRPSL GAWITYALGS       180
     ANKDLPPYVV LYNGDREPQA GSVNWSSGFL PAVYQGTAFR PGDSPILYLD RPELRTAQQQ       240
     RKSLDLLKRL NSAGAERYPS DSELRARIQS YELADRMQAA APAAVDISKE SAATKEMYGL       300
     NDKTSQSYGE VLLRARRLVE NGVRFVQVVS AVPQSLDSER RNWDAHDELE QNHGLLSKMV       360
     DKPIAGLLAD LKSRGLLDST LVVWASEFGR TSWGESGSGR DHNPWGYTQW MAGGGLKAGF       420
     TYGETDEIGL QTADKDKAMD TYDLHATILH LMGLDHLKTT FLNNGRSERP TVVYGKVVKD       480
     LLA                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page