(data stored in ACNUC7421 zone)

EMBL: CP000529.PE569

CP000529.PE569       Location/Qualifiers
FT   CDS             612254..613768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35896"
FT                   /db_xref="InterPro:IPR021485"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR8"
FT                   /protein_id="ABM35896.1"
FT                   /translation="MPSFKTTALATAVLLALSSGAVQAQAQPANEIQSLKGTVEDLRKQ
FT                   LEELRGLIQQRGAVAPAPGGATAASAGESQESVDARTAATKADIQGMRTDLENYKYDQS
FT                   RLQERNIPSVTRNTKIGGSVTVRYDIQNPEAPPSSASSGFGPTDPRHRGFNASAFGLNF
FT                   AGNLYRDYAEGRNLTYRLALTSQNTASSSSTSVNLTDAYLRYSFQPASGNAEDPLGTIT
FT                   LGQQTVPFGQDAQAQDPEVKAVIGNAGFVSGLGLNTRQTGLVLSGDYDPYVDFTNNYRA
FT                   PLLAYSLGFFNGNGANKADNNNYIDTVGRLVYTLPVDYSSWLRQLQIGGSYYRGYTSLG
FT                   TASTTATTAATSKGHNNRYGMDVNWTHLPYSVAYERAYGKQELLAATAANPDRYQRGMG
FT                   QYINFGYTWGEQFLASSRQQGKFDDYWPKSFQTFIRFDEWDPNRSGSVVNDKQFVTTLG
FT                   LNVFFAETTKFQINYLHIRNQLGGAAPTAARPASVNAIQALLNATF"
     MPSFKTTALA TAVLLALSSG AVQAQAQPAN EIQSLKGTVE DLRKQLEELR GLIQQRGAVA        60
     PAPGGATAAS AGESQESVDA RTAATKADIQ GMRTDLENYK YDQSRLQERN IPSVTRNTKI       120
     GGSVTVRYDI QNPEAPPSSA SSGFGPTDPR HRGFNASAFG LNFAGNLYRD YAEGRNLTYR       180
     LALTSQNTAS SSSTSVNLTD AYLRYSFQPA SGNAEDPLGT ITLGQQTVPF GQDAQAQDPE       240
     VKAVIGNAGF VSGLGLNTRQ TGLVLSGDYD PYVDFTNNYR APLLAYSLGF FNGNGANKAD       300
     NNNYIDTVGR LVYTLPVDYS SWLRQLQIGG SYYRGYTSLG TASTTATTAA TSKGHNNRYG       360
     MDVNWTHLPY SVAYERAYGK QELLAATAAN PDRYQRGMGQ YINFGYTWGE QFLASSRQQG       420
     KFDDYWPKSF QTFIRFDEWD PNRSGSVVND KQFVTTLGLN VFFAETTKFQ INYLHIRNQL       480
     GGAAPTAARP ASVNAIQALL NATF                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page