(data stored in ACNUC7421 zone)

EMBL: CP000529.PE570

CP000529.PE570       Location/Qualifiers
FT   CDS             613798..614886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0577"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /note="KEGG: bcn:Bcen_4344 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35897"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR9"
FT                   /protein_id="ABM35897.1"
FT                   /translation="MKRRLFNSTLLAGLGAPALIGLGGQARAAGKPTTIRIGFPGAGTG
FT                   GRPLPTSGFPANSVFRGEIEQEFAAEGIKIEWKYFVGAGPALNESYANGLLDFCFGHGD
FT                   LPLIVGRSTGLKHKILLSSGRGGDVYVVTPASSPAKSVADLKGKTLSVQKGTAGQLTLY
FT                   RVLAKYGFNDPEKEFRIISQIRDDRVASLATGDIAGAIESPFGLEARGVAKRVAEIFDD
FT                   PAINAPGSVWVGEAFEQQYPDIVQRIVTRLVKVAHWSTQEANRETQYQLWTRSGTSTYI
FT                   DNKNSWDRVKDLRTRINPLLDDYYLAAINKSIEETKKYKLTRRPVSLDGWLEPKYLNNA
FT                   LRELKLENYWPTQDAAGKFIAA"
     MKRRLFNSTL LAGLGAPALI GLGGQARAAG KPTTIRIGFP GAGTGGRPLP TSGFPANSVF        60
     RGEIEQEFAA EGIKIEWKYF VGAGPALNES YANGLLDFCF GHGDLPLIVG RSTGLKHKIL       120
     LSSGRGGDVY VVTPASSPAK SVADLKGKTL SVQKGTAGQL TLYRVLAKYG FNDPEKEFRI       180
     ISQIRDDRVA SLATGDIAGA IESPFGLEAR GVAKRVAEIF DDPAINAPGS VWVGEAFEQQ       240
     YPDIVQRIVT RLVKVAHWST QEANRETQYQ LWTRSGTSTY IDNKNSWDRV KDLRTRINPL       300
     LDDYYLAAIN KSIEETKKYK LTRRPVSLDG WLEPKYLNNA LRELKLENYW PTQDAAGKFI       360
     AA                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page