(data stored in ACNUC7421 zone)

EMBL: CP000529.PE572

CP000529.PE572       Location/Qualifiers
FT   CDS             615843..616661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0579"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_C0132 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35899"
FT                   /db_xref="GOA:A1VJS1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS1"
FT                   /protein_id="ABM35899.1"
FT                   /translation="MSDTAPLVSAGISSATSDSKTAFDWRGLVLPIAFVIVWYAVTALE
FT                   LVNTKLIVPPAGVAAQGLKELANGSFYLGIGLSLWRDLSGFTLGALAGIAVGALIGVSH
FT                   LADKVIGPTFHTARQISLFAWLPLLSALVGTGELSKIIFISFSAFYPVVLGTLEGVRGV
FT                   SRAHAEVARVYGFTPAQVFFRLILPAASPEILAGLRLGLIYAWLATIGAEYLLVNDGQG
FT                   IGNIVFKGRMAFNVELILFGLLAIGLVGNVFNRIAAVAERRLLRWRAPAR"
     MSDTAPLVSA GISSATSDSK TAFDWRGLVL PIAFVIVWYA VTALELVNTK LIVPPAGVAA        60
     QGLKELANGS FYLGIGLSLW RDLSGFTLGA LAGIAVGALI GVSHLADKVI GPTFHTARQI       120
     SLFAWLPLLS ALVGTGELSK IIFISFSAFY PVVLGTLEGV RGVSRAHAEV ARVYGFTPAQ       180
     VFFRLILPAA SPEILAGLRL GLIYAWLATI GAEYLLVNDG QGIGNIVFKG RMAFNVELIL       240
     FGLLAIGLVG NVFNRIAAVA ERRLLRWRAP AR                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page