(data stored in ACNUC7421 zone)

EMBL: CP000529.PE577

CP000529.PE577       Location/Qualifiers
FT   CDS             complement(619563..620090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0584"
FT                   /product="periplasmic protein thiol--disulfide
FT                   oxidoreductase DsbE"
FT                   /note="TIGRFAM: periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE; PFAM: Redoxin domain protein; KEGG:
FT                   dar:Daro_3997 periplasmic protein thiol:disulfide
FT                   oxidoreductase DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35904"
FT                   /db_xref="GOA:A1VJS6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS6"
FT                   /protein_id="ABM35904.1"
FT                   /translation="MRRFLFPLGLFFSLVCLLGAGLRLNPQEIPSPLIGKPAPAFALAQ
FT                   LALPDKTFGPQDMQGQVWLLNVWASWCTACRQEHPLLLELAGRNQVSIVGMDYMDARAD
FT                   GAKWLEKHGNPYRLSILDTDGKVGIDYGVYGVPETFVIDKRGVIRLKLAGPVTAEIIEK
FT                   KLLPLIKELNRA"
     MRRFLFPLGL FFSLVCLLGA GLRLNPQEIP SPLIGKPAPA FALAQLALPD KTFGPQDMQG        60
     QVWLLNVWAS WCTACRQEHP LLLELAGRNQ VSIVGMDYMD ARADGAKWLE KHGNPYRLSI       120
     LDTDGKVGID YGVYGVPETF VIDKRGVIRL KLAGPVTAEI IEKKLLPLIK ELNRA            175
//

If you have problems or comments...

PBIL Back to PBIL home page