(data stored in ACNUC7421 zone)

EMBL: CP000529.PE580

CP000529.PE580       Location/Qualifiers
FT   CDS             complement(622718..623506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0587"
FT                   /product="heme exporter protein CcmC"
FT                   /note="TIGRFAM: heme exporter protein CcmC; PFAM:
FT                   cytochrome c assembly protein; KEGG: nmu:Nmul_A1212 heme
FT                   exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35907"
FT                   /db_xref="GOA:A1VJS9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS9"
FT                   /protein_id="ABM35907.1"
FT                   /translation="MRPVLHAPFAARFFASPRPGWWKYAGAPAFYPLAGRLIPGLQAVA
FT                   VALLALGLAVGFLLAPTDHQQGDAYRIIFVHVPAAWLSMVLYVAMAFWAAMGLALNSRL
FT                   SFMMARAIAPTGAMFTFVALWTGALWGRPTWGAWWVWDARLTSELLLLFLYAGFMALQS
FT                   AIDDPRRGDRAGALLALVGVVNVPVIYFSVKWWNTLHQGASISLSSAPLMASSMLTGLL
FT                   LAALGAWVYALATVLKRLRCIVLERERHARWVAQLPEVSA"
     MRPVLHAPFA ARFFASPRPG WWKYAGAPAF YPLAGRLIPG LQAVAVALLA LGLAVGFLLA        60
     PTDHQQGDAY RIIFVHVPAA WLSMVLYVAM AFWAAMGLAL NSRLSFMMAR AIAPTGAMFT       120
     FVALWTGALW GRPTWGAWWV WDARLTSELL LLFLYAGFMA LQSAIDDPRR GDRAGALLAL       180
     VGVVNVPVIY FSVKWWNTLH QGASISLSSA PLMASSMLTG LLLAALGAWV YALATVLKRL       240
     RCIVLERERH ARWVAQLPEV SA                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page